PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G160687_P03
Common NameZm.134
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family MIKC_MADS
Protein Properties Length: 287aa    MW: 32163.9 Da    PI: 9.3363
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G160687_P03genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF95.72.1e-302776150
                       S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
             SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                       krien++ rqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyey+
  GRMZM2G160687_P03 27 KRIENNTSRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYA 76
                       79***********************************************8 PP

2K-box105.28.2e-35981936100
              K-box   6 gks.leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrk 96 
                        g   le++ ++ +qqe+akL+++i++Lq+++Rhl+G+++++LslkeL+qLe++Lek+++kiR++K+ell ++i+++ k+e elq+++++Lr+
  GRMZM2G160687_P03  98 GPPlLEHNAQQFYQQESAKLRNQIQMLQNTNRHLVGDSVGNLSLKELKQLESRLEKGISKIRARKSELLAAEISYMAKRETELQNDHMTLRT 189
                        4456788899********************************************************************************** PP

              K-box  97 klee 100
                        k+ee
  GRMZM2G160687_P03 190 KIEE 193
                        **97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006633.5851979IPR002100Transcription factor, MADS-box
SMARTSM004326.3E-411978IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.09E-322093IPR002100Transcription factor, MADS-box
CDDcd002653.04E-442091No hitNo description
PRINTSPR004045.7E-322141IPR002100Transcription factor, MADS-box
PROSITE patternPS0035002175IPR002100Transcription factor, MADS-box
PfamPF003191.8E-262875IPR002100Transcription factor, MADS-box
PRINTSPR004045.7E-324156IPR002100Transcription factor, MADS-box
PRINTSPR004045.7E-325677IPR002100Transcription factor, MADS-box
PfamPF014863.1E-25103191IPR002487Transcription factor, K-box
PROSITE profilePS5129714.786107197IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048283Biological Processindeterminate inflorescence morphogenesis
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0006310anatomytassel floret
PO:0006354anatomyear floret
PO:0006505anatomycentral spike of ear inflorescence
PO:0009001anatomyfruit
PO:0009066anatomyanther
PO:0009074anatomystyle
PO:0009084anatomypericarp
PO:0009089anatomyendosperm
PO:0001007developmental stagepollen development stage
PO:0001094developmental stageplant embryo coleoptilar stage
PO:0001095developmental stageplant embryo true leaf formation stage
PO:0001180developmental stageplant proembryo stage
PO:0007001developmental stageearly whole plant fruit ripening stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
PO:0007016developmental stagewhole plant flowering stage
PO:0007031developmental stagemid whole plant fruit ripening stage
PO:0007032developmental stagewhole plant fruit formation stage up to 10%
PO:0007072developmental stageLP.18 eighteen leaves visible stage
PO:0007633developmental stageendosperm development stage
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MSFLLKEKEM IIAAGIASMG RGRIEIKRIE NNTSRQVTFC KRRNGLLKKA YELSVLCDAE  60
VALIVFSSRG RLYEYANNSV KATIERYKKA HTVGSSSGPP LLEHNAQQFY QQESAKLRNQ  120
IQMLQNTNRH LVGDSVGNLS LKELKQLESR LEKGISKIRA RKSELLAAEI SYMAKRETEL  180
QNDHMTLRTK IEEGEQQLQQ VTVARSVAAA AAAATNLELN PFLEMDTKCF FTGGPFATLD  240
MKCFLPGSLQ QMLEAQQRQM LATELNLGYQ LAPPGSDAAD NNPHHQF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P7e-201987169Myocyte-specific enhancer factor 2B
1tqe_Q7e-201987169Myocyte-specific enhancer factor 2B
1tqe_R7e-201987169Myocyte-specific enhancer factor 2B
1tqe_S7e-201987169Myocyte-specific enhancer factor 2B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.1340.0ear| endosperm| ovary| pedicel| pericarp
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G160687
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G160687_P03
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0366950.0BT036695.1 Zea mays full-length cDNA clone ZM_BFb0132D15 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001292923.10.0Zea AGAMOUS homolog2 isoform 1
RefseqXP_008673430.10.0PREDICTED: zea AGAMOUS homolog2 isoform X2
SwissprotQ2QW531e-121MAD13_ORYSJ; MADS-box transcription factor 13
TrEMBLB4FHV70.0B4FHV7_MAIZE; Uncharacterized protein
STRINGGRMZM2G160687_P030.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64937144
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42830.14e-86MIKC_MADS family protein
Publications ? help Back to Top
  1. Alexandrov NN, et al.
    Insights into corn genes derived from large-scale cDNA sequencing.
    Plant Mol. Biol., 2009. 69(1-2): p. 179-94
    [PMID:18937034]
  2. Theissen G,Strater T,Fischer A,Saedler H
    Structural characterization, chromosomal localization and phylogenetic evaluation of two pairs of AGAMOUS-like MADS-box genes from maize.
    Gene, 1995. 156(2): p. 155-66
    [PMID:7758952]
  3. Schmidt RJ, et al.
    Identification and molecular characterization of ZAG1, the maize homolog of the Arabidopsis floral homeotic gene AGAMOUS.
    Plant Cell, 1993. 5(7): p. 729-37
    [PMID:8103379]